2m3x/1/1:A/1:F

Sequences
>2m3x-a1-m1-cA (length=147) [Search sequence]
EGVIMSELKLKPLPKVELPPDFVDVIRIKLQGKTVRTGDVIGISILGKEVKFKVVQAYPS
PLRVEDRTKITLVTHPVDVLEAKIKGIKDVILDENLIVVITEENEVLIFNQNLEELYRGK
FENLNKVLVRNDLVVIIDEQKLTLIRT
>2m3x-a1-m1-cF (length=147) [Search sequence]
EGVIMSELKLKPLPKVELPPDFVDVIRIKLQGKTVRTGDVIGISILGKEVKFKVVQAYPS
PLRVEDRTKITLVTHPVDVLEAKIKGIKDVILDENLIVVITEENEVLIFNQNLEELYRGK
FENLNKVLVRNDLVVIIDEQKLTLIRT
Structure information
PDB ID 2m3x (database links: RCSB PDB PDBe PDBj PDBsum)
Title Solution structure of Ph1500: a homohexameric protein centered on a 12-bladed beta-propeller
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 52
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A F
UniProt accession O59169 O59169
Species 70601 (Pyrococcus horikoshii OT3) 70601 (Pyrococcus horikoshii OT3)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2m3x-a1-m1-cA_2m3x-a1-m1-cF.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 2m3x-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 2m3x/1/1:E/1:F 2m3x/1/1:C/1:D
  • 4uzr/1/2:C/2:F 4uzr/1/1:A/1:D 4uzr/1/1:B/1:E 4uzr/1/1:C/1:F 4uzr/1/2:A/2:D 4uzr/1/2:B/2:E
  • 4uzr/1/2:A/2:F 4uzr/1/1:A/1:F 4uzr/1/1:B/1:D 4uzr/1/1:C/1:E 4uzr/1/2:B/2:D 4uzr/1/2:C/2:E
  • 4uzr/1/1:B/2:C 4uzr/1/1:A/2:A 4uzr/1/1:C/2:B
  • 4uzr/1/1:A/2:F 4uzr/1/1:B/2:E 4uzr/1/1:C/2:D 4uzr/1/1:D/2:C 4uzr/1/1:E/2:B 4uzr/1/1:F/2:A
  • 4uzr/1/1:D/2:F 4uzr/1/1:E/2:E 4uzr/1/1:F/2:D
  • [Back to Home]