2m6x/1/1:E/1:F

Sequences
>2m6x-a1-m1-cE (length=63) [Search sequence]
GAKNVIVLNAASAAGNHGFFWGLLVVTLAWHVKGRLVPGATYLSLGVWPLLLVRLLRPHR
ALA
>2m6x-a1-m1-cF (length=63) [Search sequence]
GAKNVIVLNAASAAGNHGFFWGLLVVTLAWHVKGRLVPGATYLSLGVWPLLLVRLLRPHR
ALA
Structure information
PDB ID 2m6x (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of the p7 channel of Hepatitis C virus, genotype 5a
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 56
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID E F
UniProt accession O39928 O39928
Species 356419 (Hepatitis C virus (isolate EUH1480)) 356419 (Hepatitis C virus (isolate EUH1480))
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2m6x-a1-m1-cE_2m6x-a1-m1-cF.pdb.gz
Full biological assembly
Download: 2m6x-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2m6x/1/1:A/1:B 2m6x/1/1:A/1:F 2m6x/1/1:B/1:C 2m6x/1/1:C/1:D 2m6x/1/1:D/1:E
Other dimers with similar sequences but different poses
  • 2m6x/1/1:D/1:F 2m6x/1/1:A/1:C 2m6x/1/1:A/1:E 2m6x/1/1:B/1:D 2m6x/1/1:B/1:F 2m6x/1/1:C/1:E
  • 2m6x/1/1:B/1:E 2m6x/1/1:A/1:D 2m6x/1/1:C/1:F
  • [Back to Home]