2met/1/1:A/1:B

Sequences
>2met-a1-m1-cA (length=37) [Search sequence]
EKTNLEIIILEGTAVIAMFFWLLLVIILRTVKRANGG
>2met-a1-m1-cB (length=37) [Search sequence]
EKTNLEIIILEGTAVIAMFFWLLLVIILRTVKRANGG
Structure information
PDB ID 2met (database links: RCSB PDB PDBe PDBj PDBsum)
Title NMR spatial structure of the trimeric mutant TM domain of VEGFR2 receptor.
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 21
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P35968 P35968
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2met-a1-m1-cA_2met-a1-m1-cB.pdb.gz
Full biological assembly
Download: 2met-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2met/1/1:A/1:C 2met/1/1:B/1:C

[Back to Home]