2mf0/1/1:A/1:B

Sequences

>2mf0-a1-m1-cA (length=59) [Search sequence]

MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQRIQAGLTAPD

>2mf0-a1-m1-cB (length=59) [Search sequence]

MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQRIQAGLTAPD

Structure information

PDB ID	2mf0 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structural basis of the non-coding RNA RsmZ acting as protein sponge: Conformer L of RsmZ(1-72)/RsmE(dimer) 1to3 complex
Assembly ID	1
Resolution	Not applicable
Method of structure determination	SOLUTION NMR
Number of inter-chain contacts	139
Sequence identity between the two chains	1.0
PubMed citation	24828038

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	P0DPC3	P0DPC3
Species	220664 (Pseudomonas protegens Pf-5)	220664 (Pseudomonas protegens Pf-5)
Function annotation	BioLiP:2mf0A	BioLiP:2mf0B

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2mf0-a1-m1-cA_2mf0-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2mf0-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

2jpp/1/1:A/1:B 2mf0/1/1:C/1:D 2mf0/1/1:E/1:F 2mf1/1/1:A/1:B 2mf1/1/1:C/1:D 2mf1/1/1:E/1:F 2mfc/1/1:A/1:C 2mfe/1/1:A/1:C 2mff/1/1:A/1:C 2mfg/1/1:A/1:C 2mfh/1/1:A/1:C