2mf0/1/1:A/1:B

Sequences
>2mf0-a1-m1-cA (length=59) [Search sequence]
MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQRIQAGLTAPD
>2mf0-a1-m1-cB (length=59) [Search sequence]
MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQRIQAGLTAPD
Structure information
PDB ID 2mf0 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structural basis of the non-coding RNA RsmZ acting as protein sponge: Conformer L of RsmZ(1-72)/RsmE(dimer) 1to3 complex
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 139
Sequence identity between the two chains 1.0
PubMed citation 24828038
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P0DPC3 P0DPC3
Species 220664 (Pseudomonas protegens Pf-5) 220664 (Pseudomonas protegens Pf-5)
Function annotation BioLiP:2mf0A BioLiP:2mf0B
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2mf0-a1-m1-cA_2mf0-a1-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 2mf0-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2jpp/1/1:A/1:B 2mf0/1/1:C/1:D 2mf0/1/1:E/1:F 2mf1/1/1:A/1:B 2mf1/1/1:C/1:D 2mf1/1/1:E/1:F 2mfc/1/1:A/1:C 2mfe/1/1:A/1:C 2mff/1/1:A/1:C 2mfg/1/1:A/1:C 2mfh/1/1:A/1:C

[Back to Home]