2mh3/1/1:A/1:B

Sequences

>2mh3-a1-m1-cA (length=70) [Search sequence]

MKPKTASEHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTV KHLRNLQRAQ

>2mh3-a1-m1-cB (length=70) [Search sequence]

MKPKTASEHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTV KHLRNLQRAQ

Structure information

PDB ID	2mh3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	NMR structure of the basic helix-loop-helix region of the transcriptional repressor HES-1
Assembly ID	1
Resolution	Not applicable
Method of structure determination	SOLUTION NMR
Number of inter-chain contacts	85
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	Q14469	Q14469
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2mh3-a1-m1-cA_2mh3-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2mh3-assembly1.cif.gz