2mjo/1/1:A/1:B

Sequences
>2mjo-a1-m1-cA (length=41) [Search sequence]
MTRGTTDNLIPVYASILAAVVVGLVAYIAFKRWNSSKQNKQ
>2mjo-a1-m1-cB (length=41) [Search sequence]
MTRGTTDNLIPVYASILAAVVVGLVAYIAFKRWNSSKQNKQ
Structure information
PDB ID 2mjo (database links: RCSB PDB PDBe PDBj PDBsum)
Title NMR structure of p75 transmembrane domain C257A mutant in DPC micelles
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 30
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P07174 P07174
Species 10116 (Rattus norvegicus) 10116 (Rattus norvegicus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2mjo-a1-m1-cA_2mjo-a1-m1-cB.pdb.gz
Full biological assembly
Download: 2mjo-assembly1.cif.gz

[Back to Home]