2mn6/1/1:A/1:B

Sequences
>2mn6-a1-m1-cA (length=47) [Search sequence]
MGGISIWQLLIIAVIVVLLFGTKKLGSIGSDLGASIKGFKKAMSDDE
>2mn6-a1-m1-cB (length=47) [Search sequence]
MGGISIWQLLIIAVIVVLLFGTKKLGSIGSDLGASIKGFKKAMSDDE
Structure information
PDB ID 2mn6 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Solution structure of dimeric TatA of twin-arginine translocation system from E. coli
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 85
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P69428 P69428
Species 83333 (Escherichia coli K-12) 83333 (Escherichia coli K-12)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2mn6-a1-m1-cA_2mn6-a1-m1-cB.pdb.gz
Full biological assembly
Download: 2mn6-assembly1.cif.gz

[Back to Home]