2mom/1/1:B/1:C

Sequences
>2mom-a1-m1-cB (length=42) [Search sequence]
SADDDNFLVPIAVGAALAGVLILVLLAYFIGLKHHHAGYEQF
>2mom-a1-m1-cC (length=42) [Search sequence]
SADDDNFLVPIAVGAALAGVLILVLLAYFIGLKHHHAGYEQF
Structure information
PDB ID 2mom (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structural insights of TM domain of LAMP-2A in DPC micelles
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 15
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B C
UniProt accession P13473 P13473
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2mom-a1-m1-cB_2mom-a1-m1-cC.pdb.gz
Full biological assembly
Download: 2mom-assembly1.cif.gz

[Back to Home]