2ms0/1/1:A/1:C

Sequences
>2ms0-a1-m1-cA (length=55) [Search sequence]
ATVVSGQKQDRQGGERRRSQLDRDQCAYCKEKGHWAKDCPKKPRGPRGPRPQTSL
>2ms0-a1-m1-cC (length=56) [Search sequence]
ATVVSGQKQDRQGGERRRSQLDRDQCAYCKEKGHWAKDCPKKPRGPRGPRPQTSLL
Structure information
PDB ID 2ms0 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Solution NMR structure pf tRNApro:MLV-Nucleocapsid (1:2) Complex
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 22
Sequence identity between the two chains 1.0
PubMed citation 25209668
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A C
UniProt accession P03355 P03355
Species 11786 (Murine leukemia virus) 11786 (Murine leukemia virus)
Function annotation BioLiP:2ms0A BioLiP:2ms0C
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2ms0-a1-m1-cA_2ms0-a1-m1-cC.pdb.gz
Full biological assembly
Download: 2ms0-assembly1.cif.gz

[Back to Home]