2mvw/1/1:A/1:B

Sequences
>2mvw-a1-m1-cA (length=51) [Search sequence]
GSRQIVDAQAVCTRCKESADFWCFECEQLLCAKCFEAHQWFLKHEARPLAE
>2mvw-a1-m1-cB (length=51) [Search sequence]
GSRQIVDAQAVCTRCKESADFWCFECEQLLCAKCFEAHQWFLKHEARPLAE
Structure information
PDB ID 2mvw (database links: RCSB PDB PDBe PDBj PDBsum)
Title Solution structure of the TRIM19 B-box1 (B1) of human promyelocytic leukemia (PML)
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 41
Sequence identity between the two chains 1.0
PubMed citation 25355412
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P29590 P29590
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:2mvwA BioLiP:2mvwB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2mvw-a1-m1-cA_2mvw-a1-m1-cB.pdb.gz
Full biological assembly
Download: 2mvw-assembly1.cif.gz

[Back to Home]