2n1f/1/1:H/1:O

Sequences
>2n1f-a1-m1-cH (length=89) [Search sequence]
GRARDAILDALENLSGDELKKFKMKLLTVQLREGYGRIPRGALLQMDAIDLTDKLVSYYL
ESYGLELTMTVLRDMGLQELAEQLQTTKE
>2n1f-a1-m1-cO (length=89) [Search sequence]
GRARDAILDALENLSGDELKKFKMKLLTVQLREGYGRIPRGALLQMDAIDLTDKLVSYYL
ESYGLELTMTVLRDMGLQELAEQLQTTKE
Structure information
PDB ID 2n1f (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure and assembly of the mouse ASC filament by combined NMR spectroscopy and cryo-electron microscopy
Assembly ID 1
Resolution 4.0Å
Method of structure determination SOLID-STATE NMR, ELECTRON MICROSCOPY
Number of inter-chain contacts 14
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID H O
UniProt accession Q9EPB4 Q9EPB4
Species 10090 (Mus musculus) 10090 (Mus musculus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2n1f-a1-m1-cH_2n1f-a1-m1-cO.pdb.gz
Full biological assembly
Download: 2n1f-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2n1f/1/1:A/1:H 2n1f/1/1:B/1:I 2n1f/1/1:C/1:J 2n1f/1/1:C/1:K 2n1f/1/1:D/1:L 2n1f/1/1:E/1:M 2n1f/1/1:F/1:M 2n1f/1/1:G/1:N
Other dimers with similar sequences but different poses
  • 2n1f/1/1:I/1:O 2n1f/1/1:A/1:G 2n1f/1/1:B/1:H 2n1f/1/1:B/1:K 2n1f/1/1:C/1:I 2n1f/1/1:C/1:L 2n1f/1/1:D/1:J 2n1f/1/1:D/1:M 2n1f/1/1:E/1:N 2n1f/1/1:F/1:L 2n1f/1/1:G/1:M 2n1f/1/1:H/1:N
  • 2n1f/1/1:D/1:E 2n1f/1/1:B/1:C
  • [Back to Home]