2n64/1/1:B/1:C

Sequences

>2n64-a1-m1-cB (length=75) [Search sequence]

GHMEGKPKMEPAASSQAAVEELRTQVRELRSIIETMKDQQKREIKQLLSELDEEKKIRLR LQMEVNDIKKALQSK

>2n64-a1-m1-cC (length=75) [Search sequence]

GHMEGKPKMEPAASSQAAVEELRTQVRELRSIIETMKDQQKREIKQLLSELDEEKKIRLR LQMEVNDIKKALQSK

Structure information

PDB ID	2n64 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	NMR Structure of the C-terminal Coiled-Coil Domain of CIN85
Assembly ID	1
Resolution	Not applicable
Method of structure determination	SOLUTION NMR
Number of inter-chain contacts	97
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	C
UniProt accession	Q96B97	Q96B97
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2n64-a1-m1-cB_2n64-a1-m1-cC.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2n64-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

2n64/1/1:A/1:B 2n64/1/1:A/1:C