2n70/1/1:A/1:C

Sequences
>2n70-a1-m1-cA (length=43) [Search sequence]
RSNDSSDPLVVAANIIGILHLILWILDRLFFKSIYRFFEHGLK
>2n70-a1-m1-cC (length=43) [Search sequence]
RSNDSSDPLVVAANIIGILHLILWILDRLFFKSIYRFFEHGLK
Structure information
PDB ID 2n70 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Two-fold symmetric structure of the 18-60 construct of S31N M2 from Influenza A in lipid bilayers
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLID-STATE NMR
Number of inter-chain contacts 28
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A C
UniProt accession P0DOF5 P0DOF5
Species 381517 (Influenza A virus (A/Udorn/307/1972(H3N2))) 381517 (Influenza A virus (A/Udorn/307/1972(H3N2)))
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2n70-a1-m1-cA_2n70-a1-m1-cC.pdb.gz
Full biological assembly
Download: 2n70-assembly1.cif.gz

[Back to Home]