2nlb/5/1:A/3:D

Sequences
>2nlb-a5-m1-cA (length=36) [Search sequence]
DHYACVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
>2nlb-a5-m3-cD (length=36) [Search sequence]
DHYACVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
Structure information
PDB ID 2nlb (database links: RCSB PDB PDBe PDBj PDBsum)
Title Human beta-defensin-1 (Mutant Asn4Ala)
Assembly ID 5
Resolution 1.85Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 17
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 3
Chain ID A D
UniProt accession P60022 P60022
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2nlb-a5-m1-cA_2nlb-a5-m3-cD.pdb.gz
Full biological assembly
Download: 2nlb-assembly5.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 2nlq/9/1:D/3:B 2nlp/5/2:B/3:C 2nlp/8/1:B/4:C 2nlp/9/2:B/3:C 2nlq/11/3:D/7:B 2nlq/5/1:D/3:B 2nlq/7/1:D/3:B 2nlq/8/1:D/3:B
  • 2nlq/7/2:A/5:C 2nlq/10/2:A/5:C 2nlq/6/2:A/5:C
    		•

    [Back to Home]