2nlf/6/1:B/5:B

Sequences
>2nlf-a6-m1-cB (length=36) [Search sequence]
DHYNCVSSGGQCEYSACPIFTKIQGTCYRGKAKCCK
>2nlf-a6-m5-cB (length=36) [Search sequence]
DHYNCVSSGGQCEYSACPIFTKIQGTCYRGKAKCCK
Structure information
PDB ID 2nlf (database links: RCSB PDB PDBe PDBj PDBsum)
Title Human beta-defensin-1 (Mutant Leu13Glu)
Assembly ID 6
Resolution 1.45Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 10
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 5
Chain ID B B
UniProt accession P60022 P60022
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2nlf-a6-m1-cB_2nlf-a6-m5-cB.pdb.gz
Full biological assembly
Download: 2nlf-assembly6.cif.gz

[Back to Home]