2nn2/2/1:A/2:B

Sequences

>2nn2-a2-m1-cA (length=117) [Search sequence]

GPIGIPFPDHSSDILSGLNEQRTQGLLCDVVILVEGREFPTHRSVLAACSQYFKKLFTSQ NVYEIDFVSAEALTALMDFAYTATLTVSTANVGDILSAARLLEIPAVSHVCADLLDR

>2nn2-a2-m2-cB (length=117) [Search sequence]

GPIGIPFPDHSSDILSGLNEQRTQGLLCDVVILVEGREFPTHRSVLAACSQYFKKLFTSQ NVYEIDFVSAEALTALMDFAYTATLTVSTANVGDILSAARLLEIPAVSHVCADLLDR

Structure information

PDB ID	2nn2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the BTB domain from the LRF/ZBTB7 transcriptional regulator
Assembly ID	2
Resolution	2.1Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	11
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	2
Chain ID	A	B
UniProt accession	O95365	O95365
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2nn2-a2-m1-cA_2nn2-a2-m2-cB.pdb.gz

Full biological assembly Download: 2nn2-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

2nn2/2/2:A/2:B 2if5/1/1:A/2:A 2nn2/1/1:A/1:B 2nn2/2/1:A/1:B