2nn2/2/2:A/2:B

Sequences
>2nn2-a2-m2-cA (length=117) [Search sequence]
GPIGIPFPDHSSDILSGLNEQRTQGLLCDVVILVEGREFPTHRSVLAACSQYFKKLFTSQ
NVYEIDFVSAEALTALMDFAYTATLTVSTANVGDILSAARLLEIPAVSHVCADLLDR
>2nn2-a2-m2-cB (length=117) [Search sequence]
GPIGIPFPDHSSDILSGLNEQRTQGLLCDVVILVEGREFPTHRSVLAACSQYFKKLFTSQ
NVYEIDFVSAEALTALMDFAYTATLTVSTANVGDILSAARLLEIPAVSHVCADLLDR
Structure information
PDB ID 2nn2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the BTB domain from the LRF/ZBTB7 transcriptional regulator
Assembly ID 2
Resolution 2.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 127
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID A B
UniProt accession O95365 O95365
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2nn2-a2-m2-cA_2nn2-a2-m2-cB.pdb.gz
Full biological assembly
Download: 2nn2-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2if5/1/1:A/2:A 2nn2/1/1:A/1:B 2nn2/2/1:A/1:B
Other dimers with similar sequences but different poses
  • 2nn2/2/1:A/2:B 2nn2/2/1:B/2:A
  • [Back to Home]