2nnc/1/1:A/2:A

Sequences
>2nnc-a1-m1-cA (length=110) [Search sequence]
SASKLDDAIAAKFGSLPIQESTAIQIKAPEIAENGAFVPVTVATSIPGATNISIFTPANF
SPMVASFDVLPRMKPEVSLRMRMAKTENLVVVVQAGGKLYRAVREVKVTI
>2nnc-a1-m2-cA (length=110) [Search sequence]
SASKLDDAIAAKFGSLPIQESTAIQIKAPEIAENGAFVPVTVATSIPGATNISIFTPANF
SPMVASFDVLPRMKPEVSLRMRMAKTENLVVVVQAGGKLYRAVREVKVTI
Structure information
PDB ID 2nnc (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of the sulfur carrier protein SoxY from Chlorobium limicola f thiosulfatophilum
Assembly ID 1
Resolution 2.14Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 26
Sequence identity between the two chains 1.0
PubMed citation 17327392
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession Q8RLX2 Q8RLX2
Species 1092 (Chlorobium limicola) 1092 (Chlorobium limicola)
Function annotation BioLiP:2nncA BioLiP:2nncA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2nnc-a1-m1-cA_2nnc-a1-m2-cA.pdb.gz
Full biological assembly
Download: 2nnc-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 2nnc/1/2:A/2:B 2nnc/1/1:A/1:B 2nnf/1/1:A/1:B 2nnf/1/2:A/2:B
  • 2nnc/1/1:A/2:B 2nnc/1/2:A/1:B 2nnf/1/1:A/2:B 2nnf/1/2:A/1:B
  • [Back to Home]