2nnc/1/1:A/2:B

Sequences

>2nnc-a1-m1-cA (length=110) [Search sequence]

SASKLDDAIAAKFGSLPIQESTAIQIKAPEIAENGAFVPVTVATSIPGATNISIFTPANF SPMVASFDVLPRMKPEVSLRMRMAKTENLVVVVQAGGKLYRAVREVKVTI

>2nnc-a1-m2-cB (length=115) [Search sequence]

SWSEKAFSASKLDDAIAAKFGSLPIQESTAIQIKAPEIAENGAFVPVTVATSIPGATNIS IFTPANFSPMVASFDVLPRMKPEVSLRMRMAKTENLVVVVQAGGKLYRAVREVKV

Structure information

PDB ID	2nnc (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of the sulfur carrier protein SoxY from Chlorobium limicola f thiosulfatophilum
Assembly ID	1
Resolution	2.14Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	16
Sequence identity between the two chains	0.982
PubMed citation	17327392

Chain information

	Chain 1	Chain 2
Model ID	1	2
Chain ID	A	B
UniProt accession	Q8RLX2	Q8RLX2
Species	1092 (Chlorobium limicola)	1092 (Chlorobium limicola)
Function annotation	BioLiP:2nncA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2nnc-a1-m1-cA_2nnc-a1-m2-cB.pdb.gz

Full biological assembly Download: 2nnc-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2nnc/1/2:A/1:B 2nnf/1/1:A/2:B 2nnf/1/2:A/1:B
Other dimers with similar sequences but different poses	2nnc/1/2:A/2:B 2nnc/1/1:A/1:B 2nnf/1/1:A/1:B 2nnf/1/2:A/2:B 2nnc/1/1:A/2:A 2nnf/1/1:A/2:A