2nnt/1/1:B/1:C

Sequences
>2nnt-a1-m1-cB (length=31) [Search sequence]
MGATAVSEWTEYKTADGKTFYYNNRTLESTW
>2nnt-a1-m1-cC (length=31) [Search sequence]
MGATAVSEWTEYKTADGKTFYYNNRTLESTW
Structure information
PDB ID 2nnt (database links: RCSB PDB PDBe PDBj PDBsum)
Title General structural motifs of amyloid protofilaments
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLID-STATE NMR
Number of inter-chain contacts 104
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B C
UniProt accession O14776 O14776
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2nnt-a1-m1-cB_2nnt-a1-m1-cC.pdb.gz
Full biological assembly
Download: 2nnt-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2nnt/1/1:A/1:B 2nnt/1/1:C/1:D

[Back to Home]