2nr5/3/5:B/5:G

Sequences
>2nr5-a3-m5-cB (length=54) [Search sequence]
TKKERIAIQRSAEEALGKLKAIRQLCGAEDQEVEIWTNRIKELEDWLWGESPIA
>2nr5-a3-m5-cG (length=56) [Search sequence]
TKKERIAIQRSAEEALGKLKAIRQLCGAESSDQEVEIWTNRIKELEDWLWGESPIA
Structure information
PDB ID 2nr5 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of Protein of Unknown Function SO2669 from Shewanella oneidensis MR-1
Assembly ID 3
Resolution 1.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 57
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 5 5
Chain ID B G
UniProt accession Q8EDS4 Q8EDS4
Species 211586 (Shewanella oneidensis MR-1) 211586 (Shewanella oneidensis MR-1)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2nr5-a3-m5-cB_2nr5-a3-m5-cG.pdb.gz
Full biological assembly
Download: 2nr5-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2nr5/1/1:A/1:E 2nr5/1/1:B/1:G 2nr5/2/1:A/1:E 2nr5/2/2:A/2:E 2nr5/2/3:F/1:H 2nr5/2/4:F/2:H 2nr5/3/1:B/1:G 2nr5/3/1:C/5:D 2nr5/3/1:D/5:C
Other dimers with similar sequences but different poses
  • 2nr5/3/5:B/5:C 2nr5/1/1:A/1:H 2nr5/1/1:B/1:C 2nr5/1/1:G/1:D 2nr5/2/1:A/1:H 2nr5/2/1:E/2:E 2nr5/2/2:A/2:H 2nr5/2/3:F/4:F 2nr5/3/1:B/1:C 2nr5/3/1:G/1:D 2nr5/3/5:G/5:D
  • 2nr5/1/1:A/1:G 2nr5/1/1:F/1:C
    		•

    [Back to Home]