2nrn/1/1:B/1:D

Sequences
>2nrn-a1-m1-cB (length=33) [Search sequence]
KVKQLADKVEELLSKNYHLANEVARLAKLVGER
>2nrn-a1-m1-cD (length=34) [Search sequence]
MKVKQLADKVEELLSKNYHLANEVARLAKLVGER
Structure information
PDB ID 2nrn (database links: RCSB PDB PDBe PDBj PDBsum)
Title Self-assembly of coiled-coil tetramers in the 1.40 A structure of a leucine-zipper mutant
Assembly ID 1
Resolution 1.4Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 48
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B D
UniProt accession P03069 P03069
Species 4932 (Saccharomyces cerevisiae) 4932 (Saccharomyces cerevisiae)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2nrn-a1-m1-cB_2nrn-a1-m1-cD.pdb.gz
Full biological assembly
Download: 2nrn-assembly1.cif.gz

[Back to Home]