2ns1/1/2:B/3:B

Sequences

>2ns1-a1-m2-cB (length=113) [Search sequence]

SMKLVTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAELYRGAEFSVNFLPKV KIDVAIADDQLDEVIDIVSKAAYTGKIGDGKIFVAELQRVIRIRTGEADEAAL

>2ns1-a1-m3-cB (length=113) [Search sequence]

SMKLVTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAELYRGAEFSVNFLPKV KIDVAIADDQLDEVIDIVSKAAYTGKIGDGKIFVAELQRVIRIRTGEADEAAL

Structure information

PDB ID	2ns1 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the e. coli ammonia channel AMTB complexed with the signal transduction protein GLNK
Assembly ID	1
Resolution	1.962Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	77
Sequence identity between the two chains	1.0
PubMed citation	17190799

Chain information

	Chain 1	Chain 2
Model ID	2	3
Chain ID	B	B
UniProt accession	P0AC55	P0AC55
Species	83333 (Escherichia coli K-12)	83333 (Escherichia coli K-12)
Function annotation	BioLiP:2ns1B	BioLiP:2ns1B

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 2ns1-a1-m2-cB_2ns1-a1-m3-cB.pdb.gz

Full biological assembly Download: 2ns1-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1gnk/2/1:B/4:B 1gnk/2/1:B/5:B 1gnk/2/4:B/5:B 2ns1/1/1:B/2:B 2ns1/1/1:B/3:B 2nuu/1/1:G/1:H 2nuu/1/1:G/1:I 2nuu/1/1:H/1:I 2nuu/2/1:J/1:K 2nuu/2/1:J/1:L 2nuu/2/1:K/1:L 2nuu/3/1:G/1:H 2nuu/3/1:G/1:I 2nuu/3/1:H/1:I 2nuu/3/1:J/1:K 2nuu/3/1:J/1:L 2nuu/3/1:K/1:L 2nuu/4/1:G/1:H 2nuu/4/1:G/1:I 2nuu/4/1:H/1:I 2nuu/4/2:J/2:K 2nuu/4/2:J/2:L 2nuu/4/2:K/2:L 2nuu/5/1:G/1:H 2nuu/5/1:G/1:I 2nuu/5/1:H/1:I 2nuu/5/3:J/3:K 2nuu/5/3:J/3:L 2nuu/5/3:K/3:L