2nsh/1/1:A/8:A

Sequences
>2nsh-a1-m1-cA (length=163) [Search sequence]
PARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAQRTPDKLFSFAESAEENGYQVI
IAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSLYSIVQMPRGIPVGTLAIGKAGA
ANAALLAAQILATHDKELHQRLNDWRKAQTDEVLENPDPRGAA
>2nsh-a1-m8-cA (length=163) [Search sequence]
PARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAQRTPDKLFSFAESAEENGYQVI
IAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSLYSIVQMPRGIPVGTLAIGKAGA
ANAALLAAQILATHDKELHQRLNDWRKAQTDEVLENPDPRGAA
Structure information
PDB ID 2nsh (database links: RCSB PDB PDBe PDBj PDBsum)
Title E. coli PurE H45Q mutant complexed with nitro-AIR
Assembly ID 1
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 93
Sequence identity between the two chains 1.0
PubMed citation 17298082
Chain information
Chain 1 Chain 2
Model ID 1 8
Chain ID A A
UniProt accession P0AG18 P0AG18
Species 562 (Escherichia coli) 562 (Escherichia coli)
Function annotation BioLiP:2nshA BioLiP:2nshA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2nsh-a1-m1-cA_2nsh-a1-m8-cA.pdb.gz
Full biological assembly
Download: 2nsh-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1d7a/1/1:A/1:O 1d7a/1/1:B/1:N 1d7a/1/1:C/1:M 1d7a/1/1:D/1:L 1qcz/1/1:A/8:A 1qcz/1/2:A/7:A 1qcz/1/3:A/6:A 1qcz/1/4:A/5:A 2ate/1/1:A/8:A 2ate/1/2:A/7:A 2ate/1/3:A/6:A 2ate/1/4:A/5:A 2nsh/1/2:A/7:A 2nsh/1/3:A/6:A 2nsh/1/4:A/5:A 2nsj/1/1:A/8:A 2nsj/1/2:A/7:A 2nsj/1/3:A/6:A 2nsj/1/4:A/5:A 2nsl/1/1:A/8:A 2nsl/1/2:A/7:A 2nsl/1/3:A/6:A 2nsl/1/4:A/5:A
Other dimers with similar sequences but different poses
  • 2nsh/1/6:A/8:A 1d7a/1/1:A/1:C 1d7a/1/1:A/1:D 1d7a/1/1:B/1:C 1d7a/1/1:B/1:D 1d7a/1/1:L/1:N 1d7a/1/1:L/1:O 1d7a/1/1:M/1:N 1d7a/1/1:M/1:O 1qcz/1/1:A/3:A 1qcz/1/1:A/4:A 1qcz/1/2:A/3:A 1qcz/1/2:A/4:A 1qcz/1/5:A/7:A 1qcz/1/5:A/8:A 1qcz/1/6:A/7:A 1qcz/1/6:A/8:A 2ate/1/1:A/3:A 2ate/1/1:A/4:A 2ate/1/2:A/3:A 2ate/1/2:A/4:A 2ate/1/5:A/7:A 2ate/1/5:A/8:A 2ate/1/6:A/7:A 2ate/1/6:A/8:A 2nsh/1/1:A/3:A 2nsh/1/1:A/4:A 2nsh/1/2:A/3:A 2nsh/1/2:A/4:A 2nsh/1/5:A/7:A 2nsh/1/5:A/8:A 2nsh/1/6:A/7:A 2nsj/1/1:A/3:A 2nsj/1/1:A/4:A 2nsj/1/2:A/3:A 2nsj/1/2:A/4:A 2nsj/1/5:A/7:A 2nsj/1/5:A/8:A 2nsj/1/6:A/7:A 2nsj/1/6:A/8:A 2nsl/1/1:A/3:A 2nsl/1/1:A/4:A 2nsl/1/2:A/3:A 2nsl/1/2:A/4:A 2nsl/1/5:A/7:A 2nsl/1/5:A/8:A 2nsl/1/6:A/7:A 2nsl/1/6:A/8:A
  • 2nsh/1/3:A/8:A 1d7a/1/1:A/1:L 1d7a/1/1:B/1:M 1d7a/1/1:C/1:O 1d7a/1/1:D/1:N 1qcz/1/1:A/5:A 1qcz/1/2:A/6:A 1qcz/1/3:A/8:A 1qcz/1/4:A/7:A 2ate/1/1:A/5:A 2ate/1/2:A/6:A 2ate/1/3:A/8:A 2ate/1/4:A/7:A 2nsh/1/1:A/5:A 2nsh/1/2:A/6:A 2nsh/1/4:A/7:A 2nsj/1/1:A/5:A 2nsj/1/2:A/6:A 2nsj/1/3:A/8:A 2nsj/1/4:A/7:A 2nsl/1/1:A/5:A 2nsl/1/2:A/6:A 2nsl/1/3:A/8:A 2nsl/1/4:A/7:A
  • [Back to Home]