2nwa/3/2:G/2:H

Sequences

>2nwa-a3-m2-cG (length=76) [Search sequence]

GPVEFNTLIVTKGKEVRIDENIFTLEKDGYRVYPEIPDVRKTKFEKSGTAEVQKLQWEEG RTIITYKLTSLHSVNL

>2nwa-a3-m2-cH (length=76) [Search sequence]

GPVEFNTLIVTKGKEVRIDENIFTLEKDGYRVYPEIPDVRKTKFEKSGTAEVQKLQWEEG RTIITYKLTSLHSVNL

Structure information

PDB ID	2nwa (database links: RCSB PDB PDBe PDBj PDBsum)
Title	X-ray Crystal Structure of Protein ytmB from Bacillus subtilis. Northeast Structural Genomics Consortium Target SR466
Assembly ID	3
Resolution	2.7Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	26
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	2	2
Chain ID	G	H
UniProt accession	O34365	O34365
Species	1423 (Bacillus subtilis)	1423 (Bacillus subtilis)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 2nwa-a3-m2-cG_2nwa-a3-m2-cH.pdb.gz

Full biological assembly Download: 2nwa-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2nwa/1/1:A/1:B 2nwa/1/1:C/1:D 2nwa/2/1:E/1:F 2nwa/2/1:G/1:H 2nwa/3/1:A/1:B 2nwa/3/1:C/1:D 2nwa/3/2:E/2:F
Other dimers with similar sequences but different poses	2nwa/3/2:F/2:H 2nwa/1/1:A/1:C 2nwa/1/1:B/1:D 2nwa/2/1:E/1:G 2nwa/2/1:F/1:H 2nwa/3/1:A/1:C 2nwa/3/1:B/1:D 2nwa/3/2:E/2:G