2nye/3/1:B/26:B

Sequences
>2nye-a3-m1-cB (length=125) [Search sequence]
THFLKIPIGDLNIITQDNKSCQTTPVIDVIQLTQGRVSSVPIIDENGYLINVYEAYDVLG
LIKLSLSVGEALRRSYTCTKNDKLSTIDNIRKARVHRFFVVDDVGRLVGVLTLSDILKYI
LLGSN
>2nye-a3-m26-cB (length=125) [Search sequence]
THFLKIPIGDLNIITQDNKSCQTTPVIDVIQLTQGRVSSVPIIDENGYLINVYEAYDVLG
LIKLSLSVGEALRRSYTCTKNDKLSTIDNIRKARVHRFFVVDDVGRLVGVLTLSDILKYI
LLGSN
Structure information
PDB ID 2nye (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the Bateman2 domain of yeast Snf4
Assembly ID 3
Resolution 2.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 15
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 26
Chain ID B B
UniProt accession P12904 P12904
Species 4932 (Saccharomyces cerevisiae) 4932 (Saccharomyces cerevisiae)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2nye-a3-m1-cB_2nye-a3-m26-cB.pdb.gz
Full biological assembly
Download: 2nye-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 2nye/4/14:B/14:A 2nyc/1/1:A/2:A 2nye/1/1:B/1:A 2nye/2/10:B/10:A 2nye/2/11:B/11:A 2nye/2/12:B/12:A 2nye/2/13:B/13:A 2nye/2/14:B/14:A 2nye/2/15:B/15:A 2nye/2/16:B/16:A 2nye/2/17:B/17:A 2nye/2/18:B/18:A 2nye/2/19:B/19:A 2nye/2/1:B/1:A 2nye/2/20:B/20:A 2nye/2/21:B/21:A 2nye/2/22:B/22:A 2nye/2/23:B/23:A 2nye/2/24:B/24:A 2nye/2/2:B/2:A 2nye/2/3:B/3:A 2nye/2/4:B/4:A 2nye/2/5:B/5:A 2nye/2/6:B/6:A 2nye/2/7:B/7:A 2nye/2/8:B/8:A 2nye/2/9:B/9:A 2nye/3/14:B/14:A 2nye/3/1:B/1:A 2nye/3/25:B/25:A 2nye/3/26:B/26:A 2nye/4/1:B/1:A
  • 2nye/4/1:A/14:A 2nye/2/10:A/23:A 2nye/2/11:A/22:A 2nye/2/12:A/21:A 2nye/2/13:A/2:A 2nye/2/15:A/4:A 2nye/2/16:A/3:A 2nye/2/17:A/7:A 2nye/2/18:A/8:A 2nye/2/19:A/5:A 2nye/2/1:A/14:A 2nye/2/20:A/6:A 2nye/2/24:A/9:A 2nye/3/1:A/14:A 2nye/3/25:A/26:A
  • 2nye/2/9:B/14:A 2nye/2/10:B/13:A 2nye/2/11:B/16:A 2nye/2/12:B/15:A 2nye/2/13:B/12:A 2nye/2/14:B/11:A 2nye/2/15:B/10:A 2nye/2/16:B/9:A 2nye/2/17:B/2:A 2nye/2/18:B/1:A 2nye/2/19:B/4:A 2nye/2/1:B/19:A 2nye/2/20:B/3:A 2nye/2/21:B/7:A 2nye/2/22:B/8:A 2nye/2/23:B/5:A 2nye/2/24:B/6:A 2nye/2/2:B/20:A 2nye/2/3:B/17:A 2nye/2/4:B/18:A 2nye/2/5:B/24:A 2nye/2/6:B/23:A 2nye/2/7:B/22:A 2nye/2/8:B/21:A
  • [Back to Home]