2nyh/3/2:B/2:A

Sequences
>2nyh-a3-m2-cB (length=113) [Search sequence]
TFRDTSAIASWHAHVYFDASSRDAAWTLREQIEAHWSGKLQLGRFHERPVGPHPWSYQLA
FTQEQFADLVGWLTLNHGALDIFLHPNTGDALRDHRDAAVWIGHSHELVLSAL
>2nyh-a3-m2-cA (length=114) [Search sequence]
GTFRDTSAIASWHAHVYFDASSRDAAWTLREQIEAHWSGKLQLGRFHERPVGPHPWSYQL
AFTQEQFADLVGWLTLNHGALDIFLHPNTGDALRDHRDAAVWIGHSHELVLSAL
Structure information
PDB ID 2nyh (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of putative dioxygenase (YP_555069.1) from Burkholderia Xenovorans LB400 at 1.70 A resolution
Assembly ID 3
Resolution 1.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 90
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID B A
UniProt accession Q13JM0 Q13JM0
Species 36873 (Paraburkholderia xenovorans) 36873 (Paraburkholderia xenovorans)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2nyh-a3-m2-cB_2nyh-a3-m2-cA.pdb.gz
Full biological assembly
Download: 2nyh-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2nyh/1/1:B/1:A 2nyh/3/1:B/1:A 2p8i/1/1:A/1:B 2p8i/2/1:C/1:D
Other dimers with similar sequences but different poses
  • 2nyh/3/1:A/2:A 2nyh/2/1:A/2:A
  • 2nyh/2/4:B/2:A 2nyh/2/3:B/1:A
  • [Back to Home]