2nzh/2/4:B/1:A

Sequences
>2nzh-a2-m4-cB (length=108) [Search sequence]
VIDDFEKLDIRTGTIVKAEEFPEARVPAIKLVIDFGTEIGIKQSSAQITKRYKPEGLINK
QVIAVVNFPPRRIAGFKSEVLVLGGIPGQGDVVLLQPDQPVPNGTKIG
>2nzh-a2-m1-cA (length=110) [Search sequence]
MAVIDDFEKLDIRTGTIVKAEEFPEARVPAIKLVIDFGTEIGIKQSSAQITKRYKPEGLI
NKQVIAVVNFPPRRIAGFKSEVLVLGGIPGQGDVVLLQPDQPVPNGTKIG
Structure information
PDB ID 2nzh (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a secretion chaperone CsaA from Bacillus subtilis in the space group P 4 21 2
Assembly ID 2
Resolution 1.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 16
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 4 1
Chain ID B A
UniProt accession P37584 P37584
Species 1423 (Bacillus subtilis) 1423 (Bacillus subtilis)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2nzh-a2-m4-cB_2nzh-a2-m1-cA.pdb.gz
Full biological assembly
Download: 2nzh-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2nzh/2/1:B/3:A 2nzh/2/2:B/4:A 2nzh/2/3:B/2:A
Other dimers with similar sequences but different poses
  • 2nzh/2/4:B/4:A 2nzh/1/1:B/1:A 2nzh/2/1:B/1:A 2nzh/2/2:B/2:A 2nzh/2/3:B/3:A 2nzo/1/1:A/1:B 2nzo/2/1:C/1:D
  • 2nzh/2/2:A/4:A 2nzh/2/1:A/3:A 2nzh/2/1:A/4:A 2nzh/2/2:A/3:A
  • [Back to Home]