2o35/1/1:A/2:B

Sequences
>2o35-a1-m1-cA (length=76) [Search sequence]
SEISPEQRTAFEAAVFRRLLEHLRERSDVQNIDLNLAGFCRNCLSNWYREAAEASGVPSK
EESREIVYGPYEEWRT
>2o35-a1-m2-cB (length=92) [Search sequence]
SEISPEQRTAFEAAVFRRLLEHLRERSDVQNIDLNLAGFCRNCLSNWYREAAEASGVPSK
EESREIVYGPYEEWRTQNGEASPEQKAAFERN
Structure information
PDB ID 2o35 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Protein of Unknown Function (DUF1244) from Sinorhizobium meliloti
Assembly ID 1
Resolution 2.12Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 20
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A B
UniProt accession Q92M60 Q92M60
Species 382 (Sinorhizobium meliloti) 382 (Sinorhizobium meliloti)
Function annotation BioLiP:2o35A BioLiP:2o35B
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2o35-a1-m1-cA_2o35-a1-m2-cB.pdb.gz
Full biological assembly
Download: 2o35-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 2o35/1/2:A/2:B 2o35/1/1:A/1:B
  • [Back to Home]