2o4t/1/1:A/2:A

Sequences
>2o4t-a1-m1-cA (length=90) [Search sequence]
HVSRVEKLPKDYQIVYKEIQKYLFKVGPVELNEGIGLLSEILGFFEEGAAAGKGVLDVTG
TDVAAFCDALIGDSKTYADLYQESIQQHVD
>2o4t-a1-m2-cA (length=90) [Search sequence]
HVSRVEKLPKDYQIVYKEIQKYLFKVGPVELNEGIGLLSEILGFFEEGAAAGKGVLDVTG
TDVAAFCDALIGDSKTYADLYQESIQQHVD
Structure information
PDB ID 2o4t (database links: RCSB PDB PDBe PDBj PDBsum)
Title CRYSTAL STRUCTURE OF a protein of the DUF1048 family with a left-handed superhelix fold (BH3976) FROM BACILLUS HALODURANS AT 1.95 A RESOLUTION
Assembly ID 1
Resolution 1.95Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 137
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession Q9K5W1 Q9K5W1
Species 86665 (Halalkalibacterium halodurans) 86665 (Halalkalibacterium halodurans)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2o4t-a1-m1-cA_2o4t-a1-m2-cA.pdb.gz
Full biological assembly
Download: 2o4t-assembly1.cif.gz

[Back to Home]