2o66/2/2:C/1:A

Sequences

>2o66-a2-m2-cC (length=106) [Search sequence]

SSDYIPDSKFYKVEAIVRPWRIQQVSSALLKIGIRGVTVSDVRGFDKFVAKVKMEIVVKK DQVESVINTIIEGARTGEIGDGKIFVLPVSDVIRVRTGERGEKAEK

>2o66-a2-m1-cA (length=107) [Search sequence]

SSDYIPDSKFYKVEAIVRPWRIQQVSSALLKIGIRGVTVSDVRGFGEDKFVAKVKMEIVV KKDQVESVINTIIEGARTGEIGDGKIFVLPVSDVIRVRTGERGEKAE

Structure information

PDB ID	2o66 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of Arabidopsis thaliana PII bound to citrate
Assembly ID	2
Resolution	1.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	28
Sequence identity between the two chains	0.991
PubMed citation	17279613

Chain information

	Chain 1	Chain 2
Model ID	2	1
Chain ID	C	A
UniProt accession	Q9ZST4	Q9ZST4
Species	3702 (Arabidopsis thaliana)	3702 (Arabidopsis thaliana)
Function annotation	BioLiP:2o66C	BioLiP:2o66A

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 2o66-a2-m2-cC_2o66-a2-m1-cA.pdb.gz

Full biological assembly Download: 2o66-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2o66/2/1:B/2:B 2o66/2/1:C/2:A 2o67/2/1:B/2:B 2o67/2/1:C/2:A 2o67/2/2:C/1:A
Other dimers with similar sequences but different poses	2o66/2/2:C/2:A 2o66/1/1:C/1:A 2o66/2/1:C/1:A 2o67/1/1:C/1:A 2o67/2/1:C/1:A 2o67/2/2:C/2:A