2o6h/2/2:A/2:B

Sequences
>2o6h-a2-m2-cA (length=147) [Search sequence]
DAPHLLIVEARFYDDLADALLDGAKAALDEAGATYDVVTVPGALEIPATISFALDGADNG
GTEYDGFVALGTVIRGETYHFDIVSNESCRALTDLSVEESIAIGNGILTVENEEQAWVRA
RREDKDKGGFAARAALTMIGLRKKFGA
>2o6h-a2-m2-cB (length=147) [Search sequence]
DAPHLLIVEARFYDDLADALLDGAKAALDEAGATYDVVTVPGALEIPATISFALDGADNG
GTEYDGFVALGTVIRGETYHFDIVSNESCRALTDLSVEESIAIGNGILTVENEEQAWVRA
RREDKDKGGFAARAALTMIGLRKKFGA
Structure information
PDB ID 2o6h (database links: RCSB PDB PDBe PDBj PDBsum)
Title Lumazine synthase RibH1 from Brucella melitensis (Gene BMEI1187, Swiss-Prot entry Q8YGH2) complexed with inhibitor 5-Nitro-6-(D-Ribitylamino)-2,4(1H,3H) Pyrimidinedione
Assembly ID 2
Resolution 2.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 93
Sequence identity between the two chains 1.0
PubMed citation 17854827
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID A B
UniProt accession Q8YGH2 Q8YGH2
Species 29459 (Brucella melitensis) 29459 (Brucella melitensis)
Function annotation BioLiP:2o6hA BioLiP:2o6hB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2o6h-a2-m2-cA_2o6h-a2-m2-cB.pdb.gz
Full biological assembly
Download: 2o6h-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2f59/1/1:A/1:B 2f59/1/1:A/1:E 2f59/1/1:B/1:C 2f59/1/1:C/1:D 2f59/1/1:E/1:D 2f59/2/1:A/1:B 2f59/2/1:A/1:E 2f59/2/1:B/1:C 2f59/2/1:C/1:D 2f59/2/1:E/1:D 2f59/2/2:A/2:B 2f59/2/2:A/2:E 2f59/2/2:B/2:C 2f59/2/2:C/2:D 2f59/2/2:E/2:D 2i0f/1/1:A/1:E 2i0f/1/1:B/1:A 2i0f/1/1:B/1:C 2i0f/1/1:D/1:C 2i0f/1/1:D/1:E 2o6h/1/1:A/1:B 2o6h/1/1:A/1:E 2o6h/1/1:C/1:B 2o6h/1/1:C/1:D 2o6h/1/1:D/1:E 2o6h/2/1:A/1:B 2o6h/2/1:A/1:E 2o6h/2/1:C/1:B 2o6h/2/1:C/1:D 2o6h/2/1:D/1:E 2o6h/2/2:A/2:E 2o6h/2/2:C/2:B 2o6h/2/2:C/2:D 2o6h/2/2:D/2:E

[Back to Home]