2o8x/3/7:B/7:C

Sequences
>2o8x-a3-m7-cB (length=61) [Search sequence]
MGFEDLVEVTTMIADLTTDQREALLLTQLLGLSYADAAAVCGCPVGTIRSRVARARDALL
A
>2o8x-a3-m7-cC (length=61) [Search sequence]
MGFEDLVEVTTMIADLTTDQREALLLTQLLGLSYADAAAVCGCPVGTIRSRVARARDALL
A
Structure information
PDB ID 2o8x (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the ""-35 element"" promoter recognition domain of Mycobacterium tuberculosis SigC
Assembly ID 3
Resolution 3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 27
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 7 7
Chain ID B C
UniProt accession P9WGH1 P9WGH1
Species 83332 (Mycobacterium tuberculosis H37Rv) 83332 (Mycobacterium tuberculosis H37Rv)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2o8x-a3-m7-cB_2o8x-a3-m7-cC.pdb.gz
Full biological assembly
Download: 2o8x-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2o8x/1/1:A/1:B 2o8x/1/1:A/1:C 2o8x/1/1:B/1:C 2o8x/2/10:A/10:B 2o8x/2/10:A/10:C 2o8x/2/10:B/10:C 2o8x/2/11:A/11:B 2o8x/2/11:A/11:C 2o8x/2/11:B/11:C 2o8x/2/12:A/12:B 2o8x/2/12:A/12:C 2o8x/2/12:B/12:C 2o8x/2/1:A/1:B 2o8x/2/1:A/1:C 2o8x/2/1:B/1:C 2o8x/2/2:A/2:B 2o8x/2/2:A/2:C 2o8x/2/2:B/2:C 2o8x/2/3:A/3:B 2o8x/2/3:A/3:C 2o8x/2/3:B/3:C 2o8x/2/4:A/4:B 2o8x/2/4:A/4:C 2o8x/2/4:B/4:C 2o8x/2/5:A/5:B 2o8x/2/5:A/5:C 2o8x/2/5:B/5:C 2o8x/2/6:A/6:B 2o8x/2/6:A/6:C 2o8x/2/6:B/6:C 2o8x/2/7:A/7:B 2o8x/2/7:A/7:C 2o8x/2/7:B/7:C 2o8x/2/8:A/8:B 2o8x/2/8:A/8:C 2o8x/2/8:B/8:C 2o8x/2/9:A/9:B 2o8x/2/9:A/9:C 2o8x/2/9:B/9:C 2o8x/3/1:A/1:B 2o8x/3/1:A/1:C 2o8x/3/1:B/1:C 2o8x/3/7:A/7:B 2o8x/3/7:A/7:C
Other dimers with similar sequences but different poses
  • 2o8x/2/11:A/9:C 2o8x/2/10:A/2:C 2o8x/2/10:C/6:A 2o8x/2/12:A/4:C 2o8x/2/12:C/8:A 2o8x/2/1:A/11:C 2o8x/2/1:C/9:A 2o8x/2/2:A/6:C 2o8x/2/3:A/7:C 2o8x/2/3:C/5:A 2o8x/2/4:A/8:C 2o8x/2/5:C/7:A
  • 2o8x/3/1:B/7:C 2o8x/2/10:B/4:C 2o8x/2/10:C/4:B 2o8x/2/11:B/2:C 2o8x/2/11:C/2:B 2o8x/2/12:B/9:C 2o8x/2/12:C/9:B 2o8x/2/1:B/7:C 2o8x/2/1:C/7:B 2o8x/2/3:B/6:C 2o8x/2/3:C/6:B 2o8x/2/5:B/8:C 2o8x/2/5:C/8:B 2o8x/3/1:C/7:B
  • 2o8x/2/11:C/9:C 2o8x/2/10:C/2:C 2o8x/2/10:C/6:C 2o8x/2/12:C/4:C 2o8x/2/12:C/8:C 2o8x/2/1:C/11:C 2o8x/2/1:C/9:C 2o8x/2/2:C/6:C 2o8x/2/3:C/5:C 2o8x/2/3:C/7:C 2o8x/2/4:C/8:C 2o8x/2/5:C/7:C
  • [Back to Home]