2oai/1/1:A/2:A

Sequences
>2oai-a1-m1-cA (length=77) [Search sequence]
EDALVTREDGSFLIDGTLPIEELREVLGANNYHTLAGCISYFGRIPHVGEYFDWAGWRIE
IVDLDGARIDLLLQRLN
>2oai-a1-m2-cA (length=77) [Search sequence]
EDALVTREDGSFLIDGTLPIEELREVLGANNYHTLAGCISYFGRIPHVGEYFDWAGWRIE
IVDLDGARIDLLLQRLN
Structure information
PDB ID 2oai (database links: RCSB PDB PDBe PDBj PDBsum)
Title The structure of transporter associated domain CorC_HlyC from a Xylella fastidiosa Temecula1 hemolysin.
Assembly ID 1
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 46
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession Q87DZ3 Q87DZ3
Species 183190 (Xylella fastidiosa Temecula1) 183190 (Xylella fastidiosa Temecula1)
Function annotation BioLiP:2oaiA BioLiP:2oaiA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2oai-a1-m1-cA_2oai-a1-m2-cA.pdb.gz
Full biological assembly
Download: 2oai-assembly1.cif.gz
Similar dimers

[Back to Home]