2oaw/5/1:B/4:D

Sequences
>2oaw-a5-m1-cB (length=65) [Search sequence]
KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVKITVNGKTYERQGFVPAAY
VKKLD
>2oaw-a5-m4-cD (length=65) [Search sequence]
KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVKITVNGKTYERQGFVPAAY
VKKLD
Structure information
PDB ID 2oaw (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of SHH variant of ""Bergerac"" chimera of spectrin SH3
Assembly ID 5
Resolution 1.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 21
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 4
Chain ID B D
UniProt accession P07751 P07751
Species 9031 (Gallus gallus) 9031 (Gallus gallus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2oaw-a5-m1-cB_2oaw-a5-m4-cD.pdb.gz
Full biological assembly
Download: 2oaw-assembly5.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 2oaw/5/3:C/4:D 2oaw/5/1:B/2:A
  • [Back to Home]