2oba/1/1:C/1:E

Sequences

>2oba-a1-m1-cC (length=120) [Search sequence]

GSHELFKEFTFESAHRLPHVPEGHKCGRLHGHSFRVAIHIEGEVDPHTGWIRDFAEIKAI FKPIYEQLDHNYLNDIPGLENPTSENLCRWIWQQLKPLLPELSKVRVHETCTSGCEYRGD

>2oba-a1-m1-cE (length=120) [Search sequence]

GSHELFKEFTFESAHRLPHVPEGHKCGRLHGHSFRVAIHIEGEVDPHTGWIRDFAEIKAI FKPIYEQLDHNYLNDIPGLENPTSENLCRWIWQQLKPLLPELSKVRVHETCTSGCEYRGD

Structure information

PDB ID	2oba (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Pseudomonas aeruginosa 6-pyruvoyl tetrahydrobiopterin synthase
Assembly ID	1
Resolution	2.33Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	66
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	E
UniProt accession	Q9I0H2	Q9I0H2
Species	287 (Pseudomonas aeruginosa)	287 (Pseudomonas aeruginosa)
Function annotation	BioLiP:2obaC	BioLiP:2obaE

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 2oba-a1-m1-cC_2oba-a1-m1-cE.pdb.gz

Full biological assembly Download: 2oba-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2oba/1/1:A/1:D 2oba/1/1:B/1:F
Other dimers with similar sequences but different poses	2oba/1/1:E/1:F 2oba/1/1:A/1:B 2oba/1/1:A/1:C 2oba/1/1:B/1:C 2oba/1/1:D/1:E 2oba/1/1:D/1:F