2obk/1/1:A/1:B

Sequences
>2obk-a1-m1-cA (length=84) [Search sequence]
RKPEVIITYCTQCQWLLRAAWLAQELLSTFSDDLGKVSLEPATGGAFRITCDGVQIWERK
ADGGFPEAKVLKQRVRDQIDPERD
>2obk-a1-m1-cB (length=85) [Search sequence]
RKPEVIITYCTQCQWLLRAAWLAQELLSTFSDDLGKVSLEPATGGAFRITCDGVQIWERK
ADGGFPEAKVLKQRVRDQIDPERDL
Structure information
PDB ID 2obk (database links: RCSB PDB PDBe PDBj PDBsum)
Title X-Ray structure of the putative Se binding protein from Pseudomonas fluorescens. Northeast Structural Genomics Consortium target PlR6.
Assembly ID 1
Resolution 2.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 58
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q4KGC5 Q4KGC5
Species 220664 (Pseudomonas protegens Pf-5) 220664 (Pseudomonas protegens Pf-5)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2obk-a1-m1-cA_2obk-a1-m1-cB.pdb.gz
Full biological assembly
Download: 2obk-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2obk/1/1:C/1:D 2obk/2/1:E/1:F 2obk/2/1:H/1:G
Other dimers with similar sequences but different poses
  • 2obk/2/1:E/1:H 2obk/1/1:A/1:D 2obk/1/1:C/1:B 2obk/2/1:G/1:F
  • [Back to Home]