2obk/2/1:E/1:H

Sequences

>2obk-a2-m1-cE (length=80) [Search sequence]

KPEVIITYCTQCQWLLRAAWLAQELLSTFSDDLGKVSLEPATGGAFRITCDGVQIWERKA DGGFPEAKVLKQRVRDQIDP

>2obk-a2-m1-cH (length=83) [Search sequence]

KPEVIITYCTQCQWLLRAAWLAQELLSTFSDDLGKVSLEPATGGAFRITCDGVQIWERKA DGGFPEAKVLKQRVRDQIDPERD

Structure information

PDB ID	2obk (database links: RCSB PDB PDBe PDBj PDBsum)
Title	X-Ray structure of the putative Se binding protein from Pseudomonas fluorescens. Northeast Structural Genomics Consortium target PlR6.
Assembly ID	2
Resolution	2.7Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	21
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	E	H
UniProt accession	Q4KGC5	Q4KGC5
Species	220664 (Pseudomonas protegens Pf-5)	220664 (Pseudomonas protegens Pf-5)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2obk-a2-m1-cE_2obk-a2-m1-cH.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2obk-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2obk/1/1:A/1:D 2obk/1/1:C/1:B 2obk/2/1:G/1:F
Other dimers with similar sequences but different poses	2obk/1/1:A/1:B 2obk/1/1:C/1:D 2obk/2/1:E/1:F 2obk/2/1:H/1:G