2obx/1/1:E/1:J

Sequences
>2obx-a1-m1-cE (length=146) [Search sequence]
ETVRIAVVRARWHADIVDQCVSAFEAEMADIGGDRFAVDVFDVPGAYEIPLHARTLAETG
RYGAVLGTAFVVNGGIYRHEFVASAVIDGMMNVQLSTGVPVLSAVLTPHNYHDSAEHHRF
FFEHFTVKGKEAARACVEILAAREKI
>2obx-a1-m1-cJ (length=146) [Search sequence]
ETVRIAVVRARWHADIVDQCVSAFEAEMADIGGDRFAVDVFDVPGAYEIPLHARTLAETG
RYGAVLGTAFVVNGGIYRHEFVASAVIDGMMNVQLSTGVPVLSAVLTPHNYHDSAEHHRF
FFEHFTVKGKEAARACVEILAAREKI
Structure information
PDB ID 2obx (database links: RCSB PDB PDBe PDBj PDBsum)
Title Lumazine synthase RibH2 from Mesorhizobium loti (Gene mll7281, Swiss-Prot entry Q986N2) complexed with inhibitor 5-Nitro-6-(D-Ribitylamino)-2,4(1H,3H) Pyrimidinedione
Assembly ID 1
Resolution 2.53Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 28
Sequence identity between the two chains 1.0
PubMed citation 17854827
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID E J
UniProt accession Q986N2 Q986N2
Species 381 (Mesorhizobium loti) 381 (Mesorhizobium loti)
Function annotation BioLiP:2obxE BioLiP:2obxJ
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2obx-a1-m1-cE_2obx-a1-m1-cJ.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 2obx-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2obx/1/1:B/1:H 2obx/1/1:C/1:G 2obx/1/1:D/1:F 2obx/1/1:I/1:A
Other dimers with similar sequences but different poses
  • 2obx/2/1:D/1:E 2obx/1/1:B/1:A 2obx/1/1:B/1:C 2obx/1/1:D/1:C 2obx/1/1:D/1:E 2obx/1/1:E/1:A 2obx/1/1:F/1:G 2obx/1/1:H/1:G 2obx/1/1:I/1:H 2obx/1/1:I/1:J 2obx/1/1:J/1:F 2obx/2/1:B/1:A 2obx/2/1:B/1:C 2obx/2/1:D/1:C 2obx/2/1:E/1:A 2obx/3/1:F/1:G 2obx/3/1:H/1:G 2obx/3/1:I/1:H 2obx/3/1:I/1:J 2obx/3/1:J/1:F
  • 2obx/1/1:E/1:I 2obx/1/1:H/1:A
  • [Back to Home]