2odk/3/4:C/4:D

Sequences
>2odk-a3-m4-cC (length=50) [Search sequence]
HVWPVQDAKARFSEFLDACITEGPQIVSRRGAEEAVLVPIGEWRRLQAAA
>2odk-a3-m4-cD (length=51) [Search sequence]
HHVWPVQDAKARFSEFLDACITEGPQIVSRRGAEEAVLVPIGEWRRLQAAA
Structure information
PDB ID 2odk (database links: RCSB PDB PDBe PDBj PDBsum)
Title Putative prevent-host-death protein from Nitrosomonas europaea
Assembly ID 3
Resolution 1.4Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 71
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 4 4
Chain ID C D
UniProt accession Q82T22 Q82T22
Species 915 (Nitrosomonas europaea) 915 (Nitrosomonas europaea)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2odk-a3-m4-cC_2odk-a3-m4-cD.pdb.gz
Full biological assembly
Download: 2odk-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2odk/1/1:A/1:B 2odk/2/1:C/1:D 2odk/3/1:A/1:B 2odk/3/2:A/2:B 2odk/3/3:C/3:D
Other dimers with similar sequences but different poses
  • 2odk/3/2:B/4:D 2odk/3/1:B/3:D 2odk/3/3:C/4:C
  • [Back to Home]