2odm/1/1:A/1:B

Sequences

>2odm-a1-m1-cA (length=76) [Search sequence]

ATKNAALKQLTKDADEILHLIKVQLDNLCPLYEEVLDTQFGLQKEVDFAVKLGLVDREDG KQILRLEKELSKLHEA

>2odm-a1-m1-cB (length=80) [Search sequence]

QATKNAALKQLTKDADEILHLIKVQLDNCPLYEEVLDTQFGLQKEVDFAVKLGLVDREDG KQILRLEKELSKLHEAFTLV

Structure information

PDB ID	2odm (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of S. aureus YlaN, an essential leucine rich protein involved in the control of cell shape
Assembly ID	1
Resolution	2.24Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	36
Sequence identity between the two chains	0.987

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	Q7A161	Q7A161
Species	196620 (Staphylococcus aureus subsp. aureus MW2)	196620 (Staphylococcus aureus subsp. aureus MW2)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2odm-a1-m1-cA_2odm-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2odm-assembly1.cif.gz