2oeq/1/1:B/1:D

Sequences

>2oeq-a1-m1-cB (length=107) [Search sequence]

EPLHALARQLEQAIRASEPFQQLKRAYEDVRRDETAYRFANVRDIQLRLHEKQRGAAILP DEIEQAQKAALAQQNEKLARLALEQQSITIAEVQQIAKPLEELHRSF

>2oeq-a1-m1-cD (length=108) [Search sequence]

SEPLHALARQLEQAIRASEPFQQLKRAYEDVRRDETAYRFANVRDIQLRLHEKQRGAAIL PDEIEQAQKAALAQQNEKLARLALEQQSITIAEVQQIAKPLEELHRSF

Structure information

PDB ID	2oeq (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Protein of Unknown Function (DUF964) from Bacillus stearothermophilus
Assembly ID	1
Resolution	2.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	104
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	D
UniProt accession	Q5L2A5	Q5L2A5
Species	1422 (Geobacillus stearothermophilus)	1422 (Geobacillus stearothermophilus)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2oeq-a1-m1-cB_2oeq-a1-m1-cD.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2oeq-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

2oeq/1/1:D/1:C 2oeq/1/1:A/1:B