2of5/1/1:D/1:E

Sequences
>2of5-a1-m1-cD (length=91) [Search sequence]
HILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYRCKANHPHNVQSQVVEAFIRWR
QRFGKQATFQSLHNGLRAVEVDPSLLLHMLE
>2of5-a1-m1-cE (length=91) [Search sequence]
HILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYRCKANHPHNVQSQVVEAFIRWR
QRFGKQATFQSLHNGLRAVEVDPSLLLHMLE
Structure information
PDB ID 2of5 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Oligomeric Death Domain complex
Assembly ID 1
Resolution 3.2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 16
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D E
UniProt accession P78560 P78560
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2of5-a1-m1-cD_2of5-a1-m1-cE.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 2of5-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2of5/1/1:A/1:B 2of5/1/1:A/1:F 2of5/1/1:C/1:D 2of5/1/1:C/1:G
Other dimers with similar sequences but different poses
  • 2of5/1/1:A/1:E 2of5/1/1:A/1:G 2of5/1/1:B/1:C 2of5/1/1:D/1:F
  • [Back to Home]