2of5/1/1:H/1:I

Sequences

>2of5-a1-m1-cH (length=100) [Search sequence]

MNLGDAETGFLTQSNLLSVAGRLGLDWPAVALHLGVSYREVQRIRHEFRDDLDEQIRHML FSWAERQAGQPGAVGLLVQALEQSDRQDVAEEVRAVLELG

>2of5-a1-m1-cI (length=100) [Search sequence]

MNLGDAETGFLTQSNLLSVAGRLGLDWPAVALHLGVSYREVQRIRHEFRDDLDEQIRHML FSWAERQAGQPGAVGLLVQALEQSDRQDVAEEVRAVLELG

Structure information

PDB ID	2of5 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Oligomeric Death Domain complex
Assembly ID	1
Resolution	3.2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	12
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	H	I
UniProt accession	Q9HB75	Q9HB75
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2of5-a1-m1-cH_2of5-a1-m1-cI.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2of5-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2of5/1/1:J/1:K 2of5/1/1:K/1:L
Other dimers with similar sequences but different poses	2of5/1/1:H/1:L 2of5/1/1:I/1:J