2of5/1/1:H/1:L

Sequences
>2of5-a1-m1-cH (length=100) [Search sequence]
MNLGDAETGFLTQSNLLSVAGRLGLDWPAVALHLGVSYREVQRIRHEFRDDLDEQIRHML
FSWAERQAGQPGAVGLLVQALEQSDRQDVAEEVRAVLELG
>2of5-a1-m1-cL (length=100) [Search sequence]
MNLGDAETGFLTQSNLLSVAGRLGLDWPAVALHLGVSYREVQRIRHEFRDDLDEQIRHML
FSWAERQAGQPGAVGLLVQALEQSDRQDVAEEVRAVLELG
Structure information
PDB ID 2of5 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Oligomeric Death Domain complex
Assembly ID 1
Resolution 3.2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 30
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID H L
UniProt accession Q9HB75 Q9HB75
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2of5-a1-m1-cH_2of5-a1-m1-cL.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 2of5-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 2of5/1/1:H/1:I 2of5/1/1:J/1:K 2of5/1/1:K/1:L
  • [Back to Home]