2ofy/1/1:B/1:A

Sequences

>2ofy-a1-m1-cB (length=78) [Search sequence]

PLTAEELERGQRLGELLRSARGDSVTVAFDAGISVETLRKIETGRIATPAFFTIAAVARV LDLSLDDVAAVVTFGPVS

>2ofy-a1-m1-cA (length=80) [Search sequence]

RVPLTAEELERGQRLGELLRSARGDSVTVAFDAGISVETLRKIETGRIATPAFFTIAAVA RVLDLSLDDVAAVVTFGPVS

Structure information

PDB ID	2ofy (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of putative XRE-family transcriptional regulator from Rhodococcus sp.
Assembly ID	1
Resolution	1.7Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	74
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	Q0S9B8	Q0S9B8
Species	101510 (Rhodococcus jostii RHA1)	101510 (Rhodococcus jostii RHA1)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2ofy-a1-m1-cB_2ofy-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2ofy-assembly1.cif.gz