2ogr/1/1:B/1:D

Sequences

>2ogr-a1-m1-cB (length=222) [Search sequence]

HGLKEEMTMKYHMEGCVNGHKFVITGEGIGYPFKGKQTINLCVIEGGPLPFSEDILSAGD
RIFTEYPQDIVDYFKNSCPAGYTWGRSFLFEDGAVCICNVDITVSVKENCIYHKSIFNGM
NFPADGPVMKKMTTNWEASCEKIMPVPKQGILKGDVSMYLLLKDGGRYRCQFDTVYKAKS
VPSKMPEWHFIQHKLLREDRSDAKNQKWQLTEHAIAFPSALA

>2ogr-a1-m1-cD (length=222) [Search sequence]

Structure information

PDB ID	2ogr (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of Yellow Fluorescent Protein from Zoanthus sp. at 1.8 A Resolution
Assembly ID	1
Resolution	1.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	47
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	D
UniProt accession	Q9U6Y4	Q9U6Y4
Species	105402 (Zoanthus sp.)	105402 (Zoanthus sp.)

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	2ogr-a1-m1-cB_2ogr-a1-m1-cD.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	2ogr-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	1xa9/1/1:A/2:A 1xa9/1/3:A/4:A 1xae/1/1:B/2:A 1xae/1/2:B/1:A 2ogr/1/1:A/1:C 5y8q/1/1:A/1:B 5y8q/1/2:A/2:B 5y8r/1/1:A/2:A 5y8r/1/3:A/4:A 6lof/1/1:A/1:B 6lof/1/2:A/2:B
Other dimers with similar sequences but different poses	5y8q/1/1:B/2:B 1xa9/1/1:A/3:A 1xa9/1/2:A/4:A 1xae/1/1:B/1:A 1xae/1/2:B/2:A 2ogr/1/1:A/1:D 2ogr/1/1:B/1:C 5y8q/1/1:A/2:A 5y8r/1/1:A/3:A 5y8r/1/2:A/4:A 6lof/1/1:A/2:A 6lof/1/1:B/2:B