2ohi/6/1:D/1:E

Sequences

>2ohi-a6-m1-cD (length=403) [Search sequence]

MKAAAKRISDGVYWTGVLDWDLRNYHGYTLQGTTYNAYLVCGDEGVALIDNSYPGTFDEL
MARVEDALQQVGMERVDYIIQNHVEKDHSGVLVELHRRFPEAPIYCTEVAVKGLLKHYPS
LREAEFMTVKTGDVLDLGGKTLTFLETPLLHWPDSMFTLLDEDGILFSNDAFGQHLCCPQ
RLDREIPEYILMDAARKFYANLITPLSKLVLKKFDEVKELGLLERIQMIAPSHGQIWTDP
MKIIEAYTGWATGMVDERVTVIYDTMHGSTRKMAHAIAEGAMSEGVDVRVYCLHEDDRSE
IVKDILESGAIALGAPTIYDEPYPSVGDLLMYLRGLKFNRTLTRKALVFGSMGGNGGATG
TMKELLAEAGFDVACEEEVYYVPTGDELDACFEAGRKLAAEIR

>2ohi-a6-m1-cE (length=403) [Search sequence]

Structure information

PDB ID	2ohi (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of coenzyme F420H2 oxidase (FprA), a diiron flavoprotein, reduced state
Assembly ID	6
Resolution	2.3Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	82
Sequence identity between the two chains	1.0
PubMed citation	17480207

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	E
UniProt accession	Q50497	Q50497
Species	145262 (Methanothermobacter thermautotrophicus)	145262 (Methanothermobacter thermautotrophicus)
Function annotation	BioLiP:2ohiD	BioLiP:2ohiE

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	2ohi-a6-m1-cD_2ohi-a6-m1-cE.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	2ohi-assembly6.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2ohh/1/1:A/1:B 2ohh/2/1:D/1:E 2ohh/3/1:A/1:B 2ohh/3/1:D/1:E 2ohi/1/1:A/1:B 2ohi/2/1:D/1:E 2ohi/3/1:G/1:H 2ohi/4/1:I/1:J 2ohi/5/1:G/1:H 2ohi/5/1:I/1:J 2ohi/6/1:A/1:B 2ohj/1/1:A/1:B 2ohj/2/1:D/1:E 2ohj/3/1:A/1:B 2ohj/3/1:D/1:E 2ohj/3/2:A/2:B 2ohj/3/2:D/2:E 2ohj/4/1:A/1:B 2ohj/4/1:D/1:E
Other dimers with similar sequences but different poses	2ohj/5/2:A/2:D 2ohh/3/1:A/1:D 2ohh/3/1:B/1:E 2ohi/5/1:G/1:I 2ohi/5/1:H/1:J 2ohi/6/1:A/1:D 2ohi/6/1:B/1:E 2ohj/3/1:A/1:D 2ohj/3/1:B/1:E 2ohj/3/2:A/2:D 2ohj/3/2:B/2:E 2ohj/4/1:A/1:D 2ohj/4/1:B/1:E 2ohj/5/1:B/1:E 2ohj/5/1:B/2:A 2ohj/3/1:A/2:B 2ohj/3/1:B/2:A