2ojl/1/2:B/2:A

Sequences
>2ojl-a1-m2-cB (length=76) [Search sequence]
PRIAIQYCTQCQWLLRAAWAQELLSTFGADLGEVALVPGTGGVFRIHYNGAPLWDREVDG
GFPEAKVLKQRVRDHL
>2ojl-a1-m2-cA (length=78) [Search sequence]
HPPRIAIQYCTQCQWLLRAAWAQELLSTFGADLGEVALVPGTGGVFRIHYNGAPLWDREV
DGGFPEAKVLKQRVRDHL
Structure information
PDB ID 2ojl (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of Q7WAF1_BORPA from Bordetella parapertussis. Northeast Structural Genomics target BpR68.
Assembly ID 1
Resolution 2.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 58
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID B A
UniProt accession Q7WAF1 Q7WAF1
Species 257311 (Bordetella parapertussis 12822) 257311 (Bordetella parapertussis 12822)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2ojl-a1-m2-cB_2ojl-a1-m2-cA.pdb.gz
Full biological assembly
Download: 2ojl-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 2ojl/1/2:B/1:A 2ojl/1/1:B/2:A
  • [Back to Home]