2omo/3/1:G/1:D

Sequences

>2omo-a3-m1-cG (length=95) [Search sequence]

GHYVTIVYASVKTDKTEAFKEATRNHEQSIREPGNRFDILQSADDPTRFVLYEAYKTRKD AAAHKETAHYLTWRDTVADWAEPRKGVIYGGLYPT

>2omo-a3-m1-cD (length=100) [Search sequence]

NLYFQGHYVTIVYASVKTDKTEAFKEATRNHEQSIREPGNRFDILQSADDPTRFVLYEAY KTRKDAAAHKETAHYLTWRDTVADWAEPRKGVIYGGLYPT

Structure information

PDB ID	2omo (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Putative antibiotic biosynthesis monooxygenase from Nitrosomonas europaea
Assembly ID	3
Resolution	1.83Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	92
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	G	D
UniProt accession	Q82WP3	Q82WP3
Species	915 (Nitrosomonas europaea)	915 (Nitrosomonas europaea)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2omo-a3-m1-cG_2omo-a3-m1-cD.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2omo-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences and structures

2omo/1/1:H/1:A 2omo/2/1:C/1:B 2omo/4/1:E/1:F